Structure of PDB 6ci0 Chain C

Receptor sequence

>6ci0C (length=531) Species: 1063 (Cereibacter sphaeroides)

WFMSTNHKDIGVLYLFTGGLVGLISVAFTVYMRMELMAPGVQFMCAEHLE
SGLVKGFFQSLWPSAVENCTPNGHLWNVMITGHGILMMFFVVIPALFGGF
GNYFMPLHIGAPDMAFPRMNNLSYWLYVAGTSLAVASLFAPGGNGQLGSG
IGWVLYPPLSTSESGYSTDLAIFAVHLSGASSILGAINMITTFLNMRAPG
MTMHKVPLFAWSIFVTAWLILLALPVLAGAITMLLTDRNFGTTFFQPSGG
GDPVLYQHILWFFGHPEVYIIVLPAFGIVSHVIATFAKKPIFGYLPMVYA
MVAIGVLGFVVWAHHMYTAGLSLTQQSYFMMATMVIAVPTGIKIFSWIAT
MWGGSIELKTPMLWALGFLFLFTVGGVTGIVLSQASVDRYYHDTYYVVAH
FHYVMSLGAVFGIFAGIYFWIGKMSGRQYPEWAGKLHFWMMFVGANLTFF
PQHFLGRQGMPRRYIDYPEAFATWNFVSSLGAFLSFASFLFFLGVIFYTL
TRGARVTANNYWNEHADTLEWTLTSPPPEHT

3D structure

• PDB: 6ci0 The K-path entrance in cytochrome c oxidase is defined by mutation of E101 and controlled by an adjacent ligand binding domain.
• Chain: C
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H102 D132 W172 S200 S201 H284 E286 Y288 S299 H333 H334 T359 K362 R481
• Catalytic site (residue number reindexed from 1): H83 D113 W153 S181 S182 H265 E267 Y269 S280 H314 H315 T340 K343 R462
• Enzyme Commision number: 7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	C	H411 D412	H392 D393
BS02	CA	C	E54 A57 G59 Q61	E35 A38 G40 Q42
BS03	CU	C	H284 H333 H334	H265 H314 H315
BS04	HEA	C	G38 T48 M51 R52 W95 I99 H102 M106 M107 V110 W172 Y414 F420 H421 M424 S425 V429 F468 R481 R482	G19 T29 M32 R33 W76 I80 H83 M87 M88 V91 W153 Y395 F401 H402 M405 S406 V410 F449 R462 R463
BS05	HEA	C	W172 W280 V287 Y288 H333 H334 I355 G360 G395 G398 I399 L401 S402 D407 H411 V416 H419 F420 V423 M424 R481	W153 W261 V268 Y269 H314 H315 I336 G341 G376 G379 I380 L382 S383 D388 H392 V397 H400 F401 V404 M405 R462

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0005515 protein binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0009060 aerobic respiration
• GO:0015990 electron transport coupled proton transport
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0045277 respiratory chain complex IV

External links

• PDB: RCSB:6ci0, PDBe:6ci0, PDBj:6ci0
• PDBsum: 6ci0
• PubMed: 29626419
• UniProt: P33517|COX1_CERSP Cytochrome c oxidase subunit 1 (Gene Name=ctaD)