Structure of PDB 6c9h Chain C

Receptor sequence

>6c9hC (length=299) Species: 9606 (Homo sapiens) [Search protein sequence]

SVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWD
SKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSF
KPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFL
KLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVS
ALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGV
LKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLT

3D structure

PDB

6c9h Structures of AMP-activated protein kinase bound to novel pharmacological activators in phosphorylated, non-phosphorylated, and nucleotide-free states.

Chain

Resolution

2.65 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	AMP	C	M84 T86 T88 D89 L128 V129 H150 R151	M59 T61 T63 D64 L103 V104 H125 R126
BS02	AMP	C	R69 I239 S241 F243 D244 R268 V275 L276 V296 H297 R298	R44 I214 S216 F218 D219 R243 V250 L251 V271 H272 R273
BS03	AMP	C	H150 T199 A204 V224 S225 H297 S313 D316	H125 T174 A179 V199 S200 H272 S288 D291

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004691	cAMP-dependent protein kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008603	cAMP-dependent protein kinase regulator activity
GO:0016208	AMP binding
GO:0019887	protein kinase regulator activity
GO:0019901	protein kinase binding
GO:0043531	ADP binding

	Biological Process
GO:0006110	regulation of glycolytic process
GO:0006468	protein phosphorylation
GO:0006633	fatty acid biosynthetic process
GO:0007165	signal transduction
GO:0007283	spermatogenesis
GO:0010628	positive regulation of gene expression
GO:0031669	cellular response to nutrient levels
GO:0045860	positive regulation of protein kinase activity
GO:0051170	import into nucleus

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane
GO:0031588	nucleotide-activated protein kinase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6c9h, PDBe:6c9h, PDBj:6c9h
PDBsum	6c9h
PubMed	30478170
UniProt	P54619\|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 (Gene Name=PRKAG1)

[Back to BioLiP]