Structure of PDB 6c9f Chain C

Receptor sequence

>6c9fC (length=300) Species: 9606 (Homo sapiens) [Search protein sequence]

NSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLW
DSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDS
FKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKF
LKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRV
SALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEG
VLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLT

3D structure

PDB

6c9f Structures of AMP-activated protein kinase bound to novel pharmacological activators in phosphorylated, non-phosphorylated, and nucleotide-free states.

Chain

Resolution

2.924 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	AMP	C	M84 T86 T88 D89 L128 V129 I149 H150 R151	M60 T62 T64 D65 L104 V105 I125 H126 R127
BS02	AMP	C	R69 I239 S241 F243 D244 R268 V275 L276 V296 H297 R298	R45 I215 S217 F219 D220 R244 V251 L252 V272 H273 R274
BS03	AMP	C	H150 T199 I203 A204 V224 S225 R298 I311 S313 S315 D316	H126 T175 I179 A180 V200 S201 R274 I287 S289 S291 D292

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004691	cAMP-dependent protein kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008603	cAMP-dependent protein kinase regulator activity
GO:0016208	AMP binding
GO:0019887	protein kinase regulator activity
GO:0019901	protein kinase binding
GO:0043531	ADP binding

	Biological Process
GO:0006110	regulation of glycolytic process
GO:0006468	protein phosphorylation
GO:0006633	fatty acid biosynthetic process
GO:0007165	signal transduction
GO:0007283	spermatogenesis
GO:0010628	positive regulation of gene expression
GO:0031669	cellular response to nutrient levels
GO:0045860	positive regulation of protein kinase activity
GO:0051170	import into nucleus

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane
GO:0031588	nucleotide-activated protein kinase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6c9f, PDBe:6c9f, PDBj:6c9f
PDBsum	6c9f
PubMed	30478170
UniProt	P54619\|AAKG1_HUMAN 5'-AMP-activated protein kinase subunit gamma-1 (Gene Name=PRKAG1)

[Back to BioLiP]