Structure of PDB 6c4h Chain C

Receptor sequence

>6c4hC (length=47) Species: 562 (Escherichia coli) [Search protein sequence]

ARWRGVRPTVRGTAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKT

3D structure

PDB

6c4h Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R212 W213 R217 P218 T219 V220 R221 G222 T223 A224 M225 N226 P227 V228 D229 H230 H232 G234 G235 E236 G237 R238 N239 F240 G241 K242 H243 P244 T246 P247 W248 Q251 T252 K253 G254 K255 K256 T257	R2 W3 R7 P8 T9 V10 R11 G12 T13 A14 M15 N16 P17 V18 D19 H20 H22 G24 G25 E26 G27 R28 N29 F30 G31 K32 H33 P34 T36 P37 W38 Q41 T42 K43 G44 K45 K46 T47

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0032297	negative regulation of DNA-templated DNA replication initiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990082	DnaA-L2 complex
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6c4h, PDBe:6c4h, PDBj:6c4h
PDBsum	6c4h
PubMed	29403017
UniProt	P60422\|RL2_ECOLI Large ribosomal subunit protein uL2 (Gene Name=rplB)