Structure of PDB 6c4h Chain C

Receptor sequence
>6c4hC (length=47) Species: 562 (Escherichia coli) [Search protein sequence]
ARWRGVRPTVRGTAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKT
3D structure
PDB6c4h Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
ChainC
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0032297 negative regulation of DNA-templated DNA replication initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990082 DnaA-L2 complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6c4h, PDBe:6c4h, PDBj:6c4h
PDBsum6c4h
PubMed29403017
UniProtP60422|RL2_ECOLI Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]