Structure of PDB 6byy Chain C

Receptor sequence
>6byyC (length=91) Species: 9606 (Homo sapiens) [Search protein sequence]
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSS
NKLFQYASTDMDKVLLKYTEYSEPHESRTNTDILETLKRRE
3D structure
PDB6byy The Cancer Mutation D83V Induces an alpha-Helix to beta-Strand Conformation Switch in MEF2B.
ChainC
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C G2 R3 K4 T20 R24 K30 G1 R2 K3 T19 R23 K29
BS02 dna C G2 R3 K5 G1 R2 K4
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6byy, PDBe:6byy, PDBj:6byy
PDBsum6byy
PubMed29477338
UniProtQ02078|MEF2A_HUMAN Myocyte-specific enhancer factor 2A (Gene Name=MEF2A);
Q02080|MEF2B_HUMAN Myocyte-specific enhancer factor 2B (Gene Name=MEF2B)

[Back to BioLiP]