Structure of PDB 6bsx Chain C

Receptor sequence
>6bsxC (length=168) Species: 9606 (Homo sapiens) [Search protein sequence]
PQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNG
QEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHG
KLLDMVGKIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKEN
QTAVDVFRRIILEAEKLE
3D structure
PDB6bsx A small molecule inhibitor of Rheb selectively targets mTORC1 signaling.
ChainC
Resolution1.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP C S16 G18 K19 S20 S21 F31 N119 K120 D122 L123 S149 A150 S15 G17 K18 S19 S20 F30 N116 K117 D119 L120 S146 A147
BS02 E7S C T61 G63 Q64 Y74 T60 G62 Q63 Y73
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0019901 protein kinase binding
GO:0030295 protein kinase activator activity
GO:0043539 protein serine/threonine kinase activator activity
GO:0046872 metal ion binding
Biological Process
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0016241 regulation of macroautophagy
GO:0031669 cellular response to nutrient levels
GO:0032006 regulation of TOR signaling
GO:0032008 positive regulation of TOR signaling
GO:0048709 oligodendrocyte differentiation
GO:0048714 positive regulation of oligodendrocyte differentiation
GO:0051726 regulation of cell cycle
GO:0120163 negative regulation of cold-induced thermogenesis
GO:1904263 positive regulation of TORC1 signaling
GO:2000074 regulation of type B pancreatic cell development
Cellular Component
GO:0000139 Golgi membrane
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0012505 endomembrane system
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0045202 synapse
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bsx, PDBe:6bsx, PDBj:6bsx
PDBsum6bsx
PubMed29416044
UniProtQ15382|RHEB_HUMAN GTP-binding protein Rheb (Gene Name=RHEB)

[Back to BioLiP]