Structure of PDB 6bhx Chain C |
>6bhxC (length=102) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] |
GSHMLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFREADFINCVT WRRQAENVANFLKKGSLAGVDGRLQTRNYENQQGQRVFVTEVQAESVQFL EP |
|
PDB | 6bhx Structural Mechanisms of Cooperative DNA Binding by Bacterial Single-Stranded DNA-Binding Proteins. |
Chain | C |
Resolution | 2.936 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
C |
H0 F91 |
H3 F88 |
|
|
|
|