Structure of PDB 6asd Chain C

Receptor sequence
>6asdC (length=45) Species: 9606 (Homo sapiens) [Search protein sequence]
GKRKRCGVCEPCQQKTNCGECTYCKNRKNSHQICKKRKCEELKKK
3D structure
PDB6asd DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
ChainC
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.14.11.80: methylcytosine dioxygenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K587 K589 T607 Y608 H616 Q617 K620 K2 K4 T22 Y23 H31 Q32 K35 PDBbind-CN: Kd=2.4uM
BS02 dna C K587 R588 H616 K623 L627 K2 R3 H31 K38 L42 PDBbind-CN: Kd=2.4uM
BS03 ZN C C591 C594 C597 C624 C6 C9 C12 C39
BS04 ZN C C603 C606 C609 C619 C18 C21 C24 C34
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:6asd, PDBe:6asd, PDBj:6asd
PDBsum6asd
PubMed29276034
UniProtQ8NFU7|TET1_HUMAN Methylcytosine dioxygenase TET1 (Gene Name=TET1)

[Back to BioLiP]