Structure of PDB 6aqp Chain C

Receptor sequence

>6aqpC (length=399) Species: 330879 (Aspergillus fumigatus Af293)

GMSSLPAVYIVSSARTPVGSFLGSLSSLTAPQLGAHAIKAALAKVDGLKP
SDVQEVFFGNVISANVGQNPARQCALGAGLEESTICTTVNKVCASGLKAI
ILGAQTIMTGNADVVVAGGTESMSNAPHYLPNLRTGAKYGHQSLVDGIMK
DGLTDAGKQELMGLQAEECAQDHGFSREQQDEYAIRTYEKAQAAQKAGLF
DEEIAPIQLPGFRGKPDVTVTQDEEPKNLNPEKLRAIKPAFIPGSGTVTA
PNSSPLNDGAAAVVLVSEAKLKELNLKPVAKILGWGDAAQQPSKFTTAPA
LAIPKALKHAGVGQDAIDAFEINEAFSVVALANMKLLGIPEEKVNLHGGA
VAIGHPIGASGARILTTLLGVLKAKKGKLGCAGICNGGGGASALVVELL

3D structure

• PDB: 6aqp Structure of Aspergillus fumigatus Cytosolic Thiolase: Trapped Tetrahedral Reaction Intermediates and Activation by Monovalent Cations
• Chain: C
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C92 H354 C384 G386
• Catalytic site (residue number reindexed from 1): C93 H355 C385 G387
• Enzyme Commision number: 2.3.1.9: acetyl-CoA C-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ACO	C	C92 L152 M161 Y187 N229 K232 L233 I236 A249 P250 S253 F294 A324 F325 H354	C93 L153 M162 Y188 N230 K233 L234 I237 A250 P251 S254 F295 A325 F326 H355

Gene Ontology

Molecular Function

• GO:0003985 acetyl-CoA C-acetyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0046872 metal ion binding

Biological Process

• GO:0006635 fatty acid beta-oxidation
• GO:0006696 ergosterol biosynthetic process
• GO:0016126 sterol biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005829 cytosol

External links

• PDB: RCSB:6aqp, PDBe:6aqp, PDBj:6aqp
• PDBsum: 6aqp
• UniProt: Q4WCL5|ER10B_ASPFU Acetyl-CoA acetyltransferase erg10B, cytosolic (Gene Name=erg10B)