Structure of PDB 5zpw Chain C

Receptor sequence
>5zpwC (length=35) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]
NLLRAIEAQQHLLQLTVWGIKQLQARLLAVERYLK
3D structure
PDB5zpw Generation of a long-acting fusion inhibitor against HIV-1.
ChainC
Resolution2.199 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C Q563 I573 Q577 Q10 I20 Q24
BS02 peptide C N554 Q562 H564 L565 L568 W571 N1 Q9 H11 L12 L15 W18
External links