Structure of PDB 5zeb Chain C

Receptor sequence

>5zebC (length=273) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]

IRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGKGGRNAHGRITTR
HKGGGHKRAYRVIDFRRHDKDGVNAKVAHIEYDPNRTANIALLHYLDGEK
RYIIAPQGLKQGDVIESGANADIKPGNNLPLRNIPAGTVIHAVELRPGGG
AKLARSAGVSIQLLGKEGTYAALRMPSGEIRRVDVRCRATVGEVGNAEQS
NINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGK
PEGRTRKPNKPSDKLIVRRRRTG

3D structure

PDB

5zeb Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	L166 R176 N203	L164 R174 N201
BS02	rna	C	R4 K7 P8 T10 P11 R13 R14 V18 K31 R35 P36 G39 K40 G42 R43 N44 A45 H46 R48 I49 T50 T51 R52 H53 K54 G56 H58 K59 R60 A61 Y62 R63 Y84 P86 N87 R88 L98 D99 G100 E101 R148 K154 L155 A156 R157 S158 A159 V161 S179 E181 R183 R188 Q201 S202 N205 W206 G207 K208 A209 G210 R211 R213 W214 R218 P219 T220 V221 R222 G223 V224 V225 M226 N227 P228 V229 D230 H231 G236 E237 G238 K239 T240 S241 G243 R244 H245 P246 P249 W250 E254 R256 T257 R258 K259 K262 R272	R2 K5 P6 T8 P9 R11 R12 V16 K29 R33 P34 G37 K38 G40 R41 N42 A43 H44 R46 I47 T48 T49 R50 H51 K52 G54 H56 K57 R58 A59 Y60 R61 Y82 P84 N85 R86 L96 D97 G98 E99 R146 K152 L153 A154 R155 S156 A157 V159 S177 E179 R181 R186 Q199 S200 N203 W204 G205 K206 A207 G208 R209 R211 W212 R216 P217 T218 V219 R220 G221 V222 V223 M224 N225 P226 V227 D228 H229 G234 E235 G236 K237 T238 S239 G241 R242 H243 P244 P247 W248 E252 R254 T255 R256 K257 K260 R270

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zeb, PDBe:5zeb, PDBj:5zeb
PDBsum	5zeb
PubMed	30206241
UniProt	A0QSD4\|RL2_MYCS2 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]