Structure of PDB 5z1q Chain C |
>5z1qC (length=75) [Search protein sequence] |
LSEEQKQEIKEAFDLFDTNKTGSIDYHELKVAMRALGFDVKKPEILELMN EYDREGNGYIGFDDFLDIMTEKIKN |
|
PDB | 5z1q Crystal structure of the trimeric N-terminal domain of ciliate Euplotes octocarinatus centrin binding with calcium ions |
Chain | C |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
C |
N39 S43 E48 |
N19 S23 E28 |
|
|
|
|