Structure of PDB 5yw3 Chain C |
>5yw3C (length=124) Species: 223 (Achromobacter cycloclastes) [Search protein sequence] |
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPKDKGHNVETIKGMIP DGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLE AVKGAKNPKKAQERLDAALAALGN |
|
PDB | 5yw3 X-ray Crystal Structure of Pseudoazurin Thr36Lys Variant |
Chain | C |
Resolution | 1.19 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
H40 C78 H81 M86 |
H40 C78 H81 M86 |
|
|
|
|