Structure of PDB 5yt7 Chain C |
>5yt7C (length=130) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
MGHSALMKGTLTLKGIAECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLS HPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHT KLIGSGEKDSVTFDVSKLKEGEQYMFFCTF |
|
PDB | 5yt7 Engineering the Metal-binding Loop of a Blue Copper Protein by Circular Permutation |
Chain | C |
Resolution | 1.66 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
H3 H65 C131 |
H3 H62 C128 |
|
|
|
|