Structure of PDB 5ypf Chain C

Receptor sequence

>5ypfC (length=45) Species: 9606 (Homo sapiens)

DVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFP

3D structure

• PDB: 5ypf Insights into degradation mechanism of N-end rule substrates by p62/SQSTM1 autophagy adapter.
• Chain: C
• Resolution: 2.951 Å

Enzymatic activity

• Enzyme Commision number:
  3.6.4.10: non-chaperonin molecular chaperone ATPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	C	C4 C7 C30	C4 C7 C30
BS02	ZN	C	C21 H36 H39	C21 H36 H39

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding

External links

• PDB: RCSB:5ypf, PDBe:5ypf, PDBj:5ypf
• PDBsum: 5ypf
• PubMed: 30120248
• UniProt: P11021|BIP_HUMAN Endoplasmic reticulum chaperone BiP (Gene Name=HSPA5);
  Q13501|SQSTM_HUMAN Sequestosome-1 (Gene Name=SQSTM1)