Structure of PDB 5yiw Chain C

Receptor sequence
>5yiwC (length=45) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence]
MSWTDERVSTLKKLWLDGLSASQIAKQLGGVTRNAVIGKVHRLGL
3D structure
PDB5yiw Structural insights into the unique mechanism of transcription activation by Caulobacter crescentus GcrA.
ChainC
Resolution1.551 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C A25 K26 G29 G30 V31 T32 R33 A25 K26 G29 G30 V31 T32 R33
BS02 dna C Q23 K26 Q23 K26
External links