Structure of PDB 5yiv Chain C

Receptor sequence
>5yivC (length=45) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence]
MSWTDERVSTLKKLWLDGLSASQIAKQLGGVTRNAVIGKVHRLGL
3D structure
PDB5yiv Structural insights into the unique mechanism of transcription activation by Caulobacter crescentus GcrA.
ChainC
Resolution2.914 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C S20 A21 S22 Q23 R33 I37 H41 S20 A21 S22 Q23 R33 I37 H41
BS02 dna C W3 T32 N34 A35 K39 R42 W3 T32 N34 A35 K39 R42
External links