Structure of PDB 5yi0 Chain C |
>5yi0C (length=146) Species: 272623 (Lactococcus lactis subsp. lactis Il1403) [Search protein sequence] |
GMSLANQIDQFLGTIMQFAENKHEILLGKAESDVKLTSTQEAILMLLAEQ ISTNAKIAEKLKISPAAVTKALKKLQEQELIKSSRATNDERVVLWSLTEK AVPVAKEHATHHEKTLSTYQELGNKFTDEEQEVISKFLSALTEEFQ |
|
PDB | 5yi0 Allosteric histidine switch for regulation of intracellular zinc(II) fluctuation. |
Chain | C |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
E24 E41 H108 H112 |
E24 E41 H108 H112 |
|
|
|
|