Structure of PDB 5xec Chain C

Receptor sequence

>5xecC (length=80) Species: 208964,608538

NEQLAKQKGCMACHDLKAKMVGPAYKDVAAKFAGQAGAEAELAQRIKNGS
QGVWGPIPMPPNAVSDDEAQTLAKWVLSQK

3D structure

• PDB: 5xec Rational Design of Domain-Swapping-Based c-Type Cytochrome Heterodimers by Using Chimeric Proteins.
• Chain: C
• Resolution: 1.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	C	P23 Y25 L42 R45 Q51 V53 W54 G55 I57 M59 N62	P23 Y25 L42 R45 Q51 V53 W54 G55 I57 M59 N62
BS02	HEC	C	C10 C13 H14	C10 C13 H14

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding

External links

• PDB: RCSB:5xec, PDBe:5xec, PDBj:5xec
• PDBsum: 5xec
• PubMed: 28660650
• UniProt: P00099|CY551_PSEAE Cytochrome c-551 (Gene Name=nirM);
  P15452|CY552_HYDTT Cytochrome c-552 (Gene Name=HTH_0988)