Structure of PDB 5x8t Chain C

Receptor sequence

>5x8tC (length=247) Species: 3562 (Spinacia oleracea) [Search protein sequence]

NPRNNLISGQRRCGKGRNARGIITARHRGGGHKRLYRKIDFRRNEKDIYG
KIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIVSGTEVPIKM
GNALPLTDMPLGTAIHNIEITLGRGGQLARAAGAVAKLIAKEGKSATLKL
PSGEVRLISKNCSATVGQVGNVGVNQKRLGRAGSKRWLGKRPVVRGVVMN
PVDHPHGGGEGRAPIGRKSPTTPWGYPALGRRSRKRNKYSDNFIIRR

3D structure

PDB

5x8t Unique localization of the plastid-specific ribosomal proteins in the chloroplast ribosome small subunit provides mechanistic insights into the chloroplastic translation

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R25 N27 G31 Q32 R34 C35 K37 G38 R39 A41 R42 G43 I44 I45 T46 A47 H49 R50 G51 G52 H54 K55 L57 Y58 R59 R64 N66 Y79 P81 R83 N84 H91 D94 G95 I142 L144 R146 Q149 L150 A151 R152 A153 A154 G155 L172 P173 S174 R178 V194 N197 K199 R200 L201 R203 A204 G205 K207 R208 W209 K212 R213 P214 V215 V216 R217 G218 V219 V220 M221 P223 V224 D225 H226 E232 G233 R234 P236 I237 G238 R239 K240 P242 T243 P245 W246 Y248 L251 G252 R253 R254 S255 R256 R258 Y261 R269	R3 N5 G9 Q10 R12 C13 K15 G16 R17 A19 R20 G21 I22 I23 T24 A25 H27 R28 G29 G30 H32 K33 L35 Y36 R37 R42 N44 Y57 P59 R61 N62 H69 D72 G73 I120 L122 R124 Q127 L128 A129 R130 A131 A132 G133 L150 P151 S152 R156 V172 N175 K177 R178 L179 R181 A182 G183 K185 R186 W187 K190 R191 P192 V193 V194 R195 G196 V197 V198 M199 P201 V202 D203 H204 E210 G211 R212 P214 I215 G216 R217 K218 P220 T221 P223 W224 Y226 L229 G230 R231 R232 S233 R234 R236 Y239 R247

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0009507	chloroplast
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5x8t, PDBe:5x8t, PDBj:5x8t
PDBsum	5x8t
PubMed	28582576
UniProt	P06509\|RK2_SPIOL Large ribosomal subunit protein uL2cz/uL2cy (Gene Name=rpl2-A)

[Back to BioLiP]