Structure of PDB 5wc0 Chain C

Receptor sequence
>5wc0C (length=277) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
YIVQAVRGTMATMSLDDIIGMHDVKQVLHEAVTLPLLVPEFFQGLRSPWK
AMVLAGPPGTGKTLIARAIASESSSTFFTVSSTDLSSKWRGDSEKIVRLL
FELARFYAPSIIFIDQIDTHEASRRVKSEFLVQMDRRVFVLAATNIPWEL
DEALRRRFEKRIFIPLPDIDARKKLIEKSMEGTPKSDEINYDDLAARTEG
FSGADVVSLCRTAAINVLRRYDTKSLRGGELTAAMESLKAELVRNIDFEA
ALQAVSPSAGPDTMLKCKEWCDSFGAM
3D structure
PDB5wc0 Katanin spiral and ring structures shed light on power stroke for microtubule severing.
ChainC
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 5.6.1.1: microtubule-severing ATPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP C R351 R352 R156 R157
BS02 ATP C P235 G236 T237 G238 K239 T240 L241 L370 P58 G59 T60 G61 K62 T63 L64 L175
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008017 microtubule binding
GO:0008568 microtubule severing ATPase activity
GO:0016853 isomerase activity
GO:0016887 ATP hydrolysis activity
GO:0019903 protein phosphatase binding
GO:0042802 identical protein binding
GO:0060090 molecular adaptor activity
GO:0090736 MATH domain binding
Biological Process
GO:0000212 meiotic spindle organization
GO:0000226 microtubule cytoskeleton organization
GO:0007019 microtubule depolymerization
GO:0007143 female meiotic nuclear division
GO:0009792 embryo development ending in birth or egg hatching
GO:0051013 microtubule severing
GO:0051229 meiotic spindle disassembly
GO:0051301 cell division
GO:0051321 meiotic cell cycle
GO:0071688 striated muscle myosin thick filament assembly
GO:1902120 negative regulation of meiotic spindle elongation
Cellular Component
GO:0000785 chromatin
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0008352 katanin complex
GO:0015630 microtubule cytoskeleton
GO:0072687 meiotic spindle
GO:0090619 meiotic spindle pole

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wc0, PDBe:5wc0, PDBj:5wc0
PDBsum5wc0
PubMed28783150
UniProtP34808|KTNA1_CAEEL Meiotic spindle formation protein mei-1 (Gene Name=mei-1)

[Back to BioLiP]