Structure of PDB 5w9s Chain C

Receptor sequence
>5w9sC (length=44) Species: 9606 (Homo sapiens) [Search protein sequence]
KKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEELKK
3D structure
PDB5w9s DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
ChainC
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K259 R260 H288 Q289 K295 L299 K2 R3 H31 Q32 K38 L42 PDBbind-CN: Kd=0.1uM
BS02 dna C S279 T286 G287 H288 S22 T29 G30 H31 PDBbind-CN: Kd=0.1uM
BS03 ZN C C263 C266 C269 C296 C6 C9 C12 C39
BS04 ZN C C275 C278 C281 C291 C18 C21 C24 C34
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5w9s, PDBe:5w9s, PDBj:5w9s
PDBsum5w9s
PubMed29276034
UniProtQ7LFL8|CXXC5_HUMAN CXXC-type zinc finger protein 5 (Gene Name=CXXC5)

[Back to BioLiP]