Structure of PDB 5vxn Chain C

Receptor sequence
>5vxnC (length=203) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAH
VLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDL
DIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAKRLSPKES
EVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLS
SVT
3D structure
PDB5vxn Structural Basis for DNA Recognition by the Two-Component Response Regulator RcsB.
ChainC
Resolution3.375 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C S152 K154 R177 S178 K180 T181 Q185 S146 K148 R171 S172 K174 T175 Q179
BS02 dna C L167 T169 S183 K186 K187 L161 T163 S177 K180 K181
Gene Ontology
Molecular Function
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0031346 positive regulation of cell projection organization
GO:0043470 regulation of carbohydrate catabolic process
GO:0044011 single-species biofilm formation on inanimate substrate
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0046677 response to antibiotic
GO:1901913 regulation of capsule organization
GO:1902021 regulation of bacterial-type flagellum-dependent cell motility
GO:1990451 cellular stress response to acidic pH
Cellular Component
GO:0005667 transcription regulator complex
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vxn, PDBe:5vxn, PDBj:5vxn
PDBsum5vxn
PubMed29487239
UniProtP0DMC7|RCSB_ECOLI Transcriptional regulatory protein RcsB (Gene Name=rcsB)

[Back to BioLiP]