Structure of PDB 5vvk Chain C

Receptor sequence

>5vvkC (length=267) Species: 83333 (Escherichia coli K-12)

VSMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRVSHAA
VRLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLYQAKLALDEDLRLK
VVRKMFELRFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRR
YDPKDWEKGDTINQCISAATSCLYGVTEAAILAAGYAPAIGFVHTGKPLS
FVYDIADIIKFDTVVPKAFEIARRNPGEPDREVRLACRDIFRSSKTLAKL
IPLIEDVLAAGEIQPPA

3D structure

• PDB: 5vvk Structures of the CRISPR genome integration complex.
• Chain: C
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	Y22 G23 Q24 K37 G57 R59	Y8 G9 Q10 K23 G43 R45
BS02	dna	C	E135 Q136 R138 G139 I140 G142 S143 V145 R146 Y149 W160 G162 R163	E121 Q122 R124 G125 I126 G128 S129 V131 R132 Y135 W146 G148 R149
BS03	dna	C	Y22 G79 E80 R84 Y86 Y165 D166 W170 S181 Y188 H208 T209 G210 K211 Y217 D244 R245 R248	Y8 G65 E66 R70 Y72 Y151 D152 W156 S167 Y174 H194 T195 G196 K197 Y203 D230 R231 R234

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004520 DNA endonuclease activity
• GO:0005515 protein binding
• GO:0008821 crossover junction DNA endonuclease activity
• GO:0017108 5'-flap endonuclease activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0043571 maintenance of CRISPR repeat elements
• GO:0051607 defense response to virus
• GO:0099048 CRISPR-cas system

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5vvk, PDBe:5vvk, PDBj:5vvk
• PDBsum: 5vvk
• PubMed: 28729350
• UniProt: Q46896|CAS1_ECOLI CRISPR-associated endonuclease Cas1 (Gene Name=ygbT)