Structure of PDB 5vfx Chain C

Receptor sequence
>5vfxC (length=100) Species: 1502 (Clostridium perfringens) [Search protein sequence]
KDLNLYAKELVDVVNYLMKKNQLVFSRNNKFIYVNTETIKSMLEKRNYDT
VDGKLYLWRELEWIECAEDRFNKRIKIDGENMYAVVIKYSSYSILKRLYL
3D structure
PDB5vfx Crystal structure of TcpK in complex with oriT DNA of the antibiotic resistance plasmid pCW3.
ChainC
Resolution2.81 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K41 R60 D70 R71 F72 N73 R75 Y84 K40 R59 D69 R70 F71 N72 R74 Y83 PDBbind-CN: Kd=360nM
BS02 dna C S27 R28 Y34 K74 R75 K77 D79 G80 N82 S26 R27 Y33 K73 R74 K76 D78 G79 N81 PDBbind-CN: Kd=360nM
External links