Structure of PDB 5ve9 Chain C |
>5ve9C (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] |
DADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTV MVRVGGGWMALDEFLVKNDPCRAR |
|
PDB | 5ve9 Structure of the ACF7 EF-Hand-GAR Module and Delineation of Microtubule Binding Determinants. |
Chain | C |
Resolution | 2.795 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
D7186 C7188 |
D69 C71 |
|
|
|
|