Structure of PDB 5vc9 Chain C

Receptor sequence
>5vc9C (length=46) Species: 9606 (Homo sapiens) [Search protein sequence]
KKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKP
3D structure
PDB5vc9 DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
ChainC
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R136 H164 R170 K171 R3 H31 R37 K38 PDBbind-CN: Kd=0.16uM
BS02 ZN C C139 C142 C145 C172 C6 C9 C12 C39
BS03 ZN C C151 C154 C157 C167 C18 C21 C24 C34
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5vc9, PDBe:5vc9, PDBj:5vc9
PDBsum5vc9
PubMed29276034
UniProtQ9H2H0|CXXC4_HUMAN CXXC-type zinc finger protein 4 (Gene Name=CXXC4)

[Back to BioLiP]