Structure of PDB 5vb0 Chain C |
>5vb0C (length=143) Species: 562 (Escherichia coli) [Search protein sequence] |
MLQGLNHLTLAVSDLASSLAFYQQLPGMRLHASWDSGAYLSCGALWLCLS LDEQRRKTPPQESDYTHYAFSVAEEEFAGVVALLAQAGAEVWKDNRSEGA SYYFLDPDGHKLELHVGNLAQRLAACRERPYKGMVFFDHHHHH |
|
PDB | 5vb0 Structure and Dynamics of FosA-Mediated Fosfomycin Resistance in Klebsiella pneumoniae and Escherichia coli. |
Chain | C |
Resolution | 2.689 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
C |
H67 E113 |
H67 E113 |
|
|
|
|