Structure of PDB 5v7q Chain C

Receptor sequence

>5v7qC (length=272) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]

AIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRITT
RHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGE
KRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPGG
GAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAEQ
ANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWG
KPEGRTRNANKSSNKFIVRRRR

3D structure

PDB

5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.

Chain

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	K7 P8 T9 P11 R13 R14 F21 R26 L37 H38 G39 G42 R43 N44 A45 H46 G47 R48 I49 T50 H53 K54 G56 K59 R60 A61 Y62 R68 K78 Y84 P86 R88 L98 D99 G100 R134 L147 R148 G150 K154 L155 A156 R157 S158 A159 G160 E169 A170 M177 P178 S179 E181 R183 R188 A199 W206 G207 K208 A209 G210 R211 R213 W214 K217 R218 P219 S220 R222 G223 V224 V225 M226 N227 V229 D230 H231 G236 G238 K239 S241 G242 G243 R244 P246 W250 E254 R256 T257 R258 N259 N261 S264 R270 R271 R272	K6 P7 T8 P10 R12 R13 F20 R25 L36 H37 G38 G41 R42 N43 A44 H45 G46 R47 I48 T49 H52 K53 G55 K58 R59 A60 Y61 R67 K77 Y83 P85 R87 L97 D98 G99 R133 L146 R147 G149 K153 L154 A155 R156 S157 A158 G159 E168 A169 M176 P177 S178 E180 R182 R187 A198 W205 G206 K207 A208 G209 R210 R212 W213 K216 R217 P218 S219 R221 G222 V223 V224 M225 N226 V228 D229 H230 G235 G237 K238 S240 G241 G242 R243 P245 W249 E253 R255 T256 R257 N258 N260 S263 R269 R270 R271

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0005886	plasma membrane
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum	5v7q
PubMed	28977617
UniProt	P9WHA5\|RL2_MYCTU Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]