Structure of PDB 5uxe Chain C

Receptor sequence

>5uxeC (length=343) Species: 1502 (Clostridium perfringens)

ARILKTAYTFDDVLLVPNKSEVLPNEVSLKTQLTKKIQLNIPLMSASMDT
VTESKMAIAMAREGGIGIIHKNMTIEDQAREVDRVKRSGGLLCGASIGVT
NDMMERVDAVVKAKVDVIVLDTAHGHSKGVIEGVKRIKAKYPELQVIAGN
IATPEAVRDLAEAGADCVKVGIGPGSICTTRIVAGVGVPQLTAVMDCAEE
GKKLGIPVIADGGLKYSGDIVKALAAGACAAMMGSIFAGCEEAPGAIEIY
QGRSYKVYRGMGSLGAMAFVPEGVEGRIAYKGHLADTIYQLIGGIKSGMG
YLGAPTLENLYENANFVVQTSAGFRESHPHDINITKEAPNYSV

3D structure

• PDB: 5uxe Crystal Structure of Inosine 5'-monophosphate Dehydrogenase from Clostridium perfringens Complexed with IMP and P178
• Chain: C
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.205: IMP dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	8LA	C	L24 P25 S436 G439 Y440	L23 P24 S297 G300 Y301
BS02	IMP	C	M49 G300 S301 I302 C303 D336 G338 M358 S360 Y383 G385 M386 G387 E411	M48 G175 S176 I177 C178 D211 G213 M233 S235 Y258 G260 M261 G262 E272
BS03	8LA	C	T247 A248 H249 S252 M386 G387 M392 E411	T122 A123 H124 S127 M261 G262 M267 E272

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0003938 IMP dehydrogenase activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0006164 purine nucleotide biosynthetic process

External links

• PDB: RCSB:5uxe, PDBe:5uxe, PDBj:5uxe
• PDBsum: 5uxe
• UniProt: A0A127ELD1