Structure of PDB 5urq Chain C

Receptor sequence

>5urqC (length=354) Species: 32022 (Campylobacter jejuni subsp. jejuni)

AMKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAMD
TVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSERKEYPDANKD
NFGRLRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAIK
AKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVGV
PQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLA
GTDESPGELFTYQGRQYKSYRGMGSLGAMQKLVPEGIEGRVPYVGSIRSV
VHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITHE
APNY

3D structure

• PDB: 5urq Crystal Structure of the Catalytic Domain of the Inosine Monophosphate Dehydrogenase from Campylobacter jejuni in the complex with inhibitor p176
• Chain: C
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	IMP	C	M48 G298 S299 I300 C301 D334 G335 G336 G357 S358 Y381 G383 M384 G385 E411	M49 G187 S188 I189 C190 D223 G224 G225 G246 S247 Y270 G272 M273 G274 E285
BS02	8L7	C	V224 S245 A246 S250 G252 I253 M384 G385 M390 E411	V113 S134 A135 S139 G141 I142 M273 G274 M279 E285
BS03	8L7	C	P24 S436 G439 Y440	P25 S310 G313 Y314

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 15:36:15 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5urq', asym_id = 'C', title = 'Crystal Structure of the Catalytic Domain of the...bacter jejuni in the complex with inhibitor p176 '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5urq', asym_id='C', title='Crystal Structure of the Catalytic Domain of the...bacter jejuni in the complex with inhibitor p176 ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003824,0003938,0006164,0016491', uniprot = '', pdbid = '5urq', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824,0003938,0006164,0016491', uniprot='', pdbid='5urq', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>