Structure of PDB 5uqg Chain C

Receptor sequence
>5uqgC (length=356) Species: 32022 (Campylobacter jejuni subsp. jejuni) [Search protein sequence]
AMKIVKRALTFEDVLLRPGYSEVLPKEVKIHTKLTKNITLNMPLISAAMD
TVTEHRAAIMMARLGGLGVIHKNMDIASQVREVKRVKKSEKRKEYPDANK
DNFGRLRVGAAIGVGQMDRVDALVEAGVDVVVLDSAHGHSKGIIDTVKAI
KAKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVG
VPQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLL
AGTDESPGELFTYQGRQYKSYRGMGSLGAMQKLVPEGIEGRVPYVGSIRS
VVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKESHVHDVTITH
EAPNYK
3D structure
PDB5uqg Crystal Structure of the Catalytic Domain of the Inosine Monophosphate Dehydrogenase from Campylobacter jejuni in the complex with inhibitor p200
ChainC
Resolution2.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 IMP C M48 G298 S299 I300 C301 D334 G357 S358 Y381 G383 M384 G385 E411 M49 G188 S189 I190 C191 D224 G247 S248 Y271 G273 M274 G275 E286
BS02 8L4 C A246 M384 G385 E411 A136 M274 G275 E286
BS03 8L4 C P24 S436 G439 Y440 P25 S311 G314 Y315
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 12:33:15 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5uqg', asym_id = 'C', title = 'Crystal Structure of the Catalytic Domain of the...bacter jejuni in the complex with inhibitor p200 '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5uqg', asym_id='C', title='Crystal Structure of the Catalytic Domain of the...bacter jejuni in the complex with inhibitor p200 ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003824,0003938,0006164,0016491', uniprot = '', pdbid = '5uqg', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824,0003938,0006164,0016491', uniprot='', pdbid='5uqg', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>