Structure of PDB 5t7o Chain C

Receptor sequence

>5t7oC (length=487) Species: 353153 (Trypanosoma cruzi strain CL Brener)

SLFKIRMPETVAEGTRLALRAFSLVVAVDEHGGIGNVPEDMKFFRDLTTK
LRNVKPSPAKRNAVVMGRKTWDSIPPKFRPLPGRLNVVLSSTLTTQHLLD
GLDSIVAVNGGLEQALRLLASPNYTPSIETVYCIGGGSVYAEALRPPCVH
LLQAIYRTTIRAVFFRVPESGTEAAAGIEWQRETISEELTSANGNETKYY
FEKLIPRNREEEQYLSLVDRIIREGNVKHDTGVGTLSIFGAQMRFSLRNN
RLPLLTTKRVFWRGVCEELLWFLRGETYAKKLSDKGVHIWDDNGSRAFLD
SRGLTEYEEMDLGPVYGFQWRHFGAAYTHHDANYDGQGVDQIKAIVETLK
TNPDDRRMLFTAWNPSALPRMALPPCHLLAQFYVSNGELSCMLYQRSCDM
GLGVPFNIASYALLTILIAKATGLRPGELVHTLGDAHVYSNHVEPCNEQL
KRVPRAFPYLVFRREREFLEDYEEGDMEVIDYAPYPP

3D structure

• PDB: 5t7o Crystal structure of Trypanosoma cruzi Dihydrofolate Reductase-Thymidylate Synthase in complex with (6S)-5,6,7,8-TETRAHYDROFOLATE
• Chain: C
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D48 E295 W317 Y343 C403 R423 D426
• Catalytic site (residue number reindexed from 1): D40 E268 W290 Y316 C376 R396 D399
• Enzyme Commision number: 1.5.1.3: dihydrofolate reductase.
  2.1.1.45: thymidylate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	THG	C	V26 V27 A28 D48 M49 F52 R53 F88 L91 R94 I154	V25 V26 A27 D40 M41 F44 R45 F78 L81 R84 I134
BS02	NAP	C	V27 A28 I35 G36 G77 R78 K79 T80 S83 L99 S100 S101 G130 G131 G156 G157 S158	V26 A27 I34 G35 G67 R68 K69 T70 S73 L89 S90 S91 G110 G111 G136 G137 S138
BS03	UMP	C	C403 Q422 R423 S424 D426 G430 N434 H464 Y466	C376 Q395 R396 S397 D399 G403 N407 H437 Y439

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004146 dihydrofolate reductase activity
• GO:0004799 thymidylate synthase activity
• GO:0008168 methyltransferase activity
• GO:0016491 oxidoreductase activity
• GO:0016741 transferase activity, transferring one-carbon groups

Biological Process

• GO:0006231 dTMP biosynthetic process
• GO:0006730 one-carbon metabolic process
• GO:0009165 nucleotide biosynthetic process
• GO:0032259 methylation
• GO:0046654 tetrahydrofolate biosynthetic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005829 cytosol

External links

• PDB: RCSB:5t7o, PDBe:5t7o, PDBj:5t7o
• PDBsum: 5t7o
• UniProt: Q4DLS1