Structure of PDB 5t7h Chain C

Receptor sequence

>5t7hC (length=106) Species: 559292 (Saccharomyces cerevisiae S288C)

FKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYS
YTDANIKKNVLWDENNMSEYLTNPAKYIPGTKMAFGGLKKEKDRNDLITY
LKKASE

3D structure

• PDB: 5t7h Cytochrome c Can Form a Well-Defined Binding Pocket for Hydrocarbons.
• Chain: C
• Resolution: 2.003 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	C	A81 F82 G83 L94	A84 F85 G86 L97
BS02	ZE7	C	S40 K55 Y67 Y74	S43 K58 Y70 Y77
BS03	HEC	C	R13 C14 C17 H18 G29 P30 G41 Y48 T49 W59 M64 Y67 L68	R16 C17 C20 H21 G32 P33 G44 Y51 T52 W62 M67 Y70 L71

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:5t7h, PDBe:5t7h, PDBj:5t7h
• PDBsum: 5t7h
• PubMed: 27990813
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)