Structure of PDB 5t5t Chain C

Receptor sequence

>5t5tC (length=293) Species: 10116 (Rattus norvegicus)

SVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWD
SKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSF
KPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFL
KLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVS
ALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHREGVLKCY
LHETLEAIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALV

3D structure

• PDB: 5t5t Selective Activation of AMPK beta 1-Containing Isoforms Improves Kidney Function in a Rat Model of Diabetic Nephropathy.
• Chain: C
• Resolution: 3.46 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AMP	C	H150 T199 I203 A204 V224 S225 H297 I311 S313 S315 D316	H125 T174 I178 A179 V199 S200 H268 I282 S284 S286 D287
BS02	AMP	C	I239 S241 F243 D244 R268 L276 V296 H297 R298	I214 S216 F218 D219 R243 L247 V267 H268 R269
BS03	ADP	C	R69 M84 T86 T88 D89 Y120 V129 H150 R151	R44 M59 T61 T63 D64 Y95 V104 H125 R126

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004679 AMP-activated protein kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016208 AMP binding
• GO:0019887 protein kinase regulator activity
• GO:0019901 protein kinase binding
• GO:0043531 ADP binding
• GO:0044877 protein-containing complex binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0010628 positive regulation of gene expression
• GO:0031669 cellular response to nutrient levels
• GO:0051170 import into nucleus

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0031588 nucleotide-activated protein kinase complex
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:5t5t, PDBe:5t5t, PDBj:5t5t
• PDBsum: 5t5t
• PubMed: 28289077
• UniProt: P80385|AAKG1_RAT 5'-AMP-activated protein kinase subunit gamma-1 (Gene Name=Prkag1)