Structure of PDB 5sup Chain C

Receptor sequence

>5supC (length=381) Species: 559292 (Saccharomyces cerevisiae S288C)

FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKT
AVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTA
VFYGGTPISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFV
IDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQ
NPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDLEFNQVIIFV
KSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVST
DVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSK
EDEEVLAKIQERFDVKIAEFPEEGIDPSTYL

3D structure

• PDB: 5sup Structural and biochemical analyses of the DEAD-box ATPase Sub2 in association with THO or Yra1.
• Chain: C
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	R228 Q231 F234 R235 T237 P238 R239 R260 Q263	R165 Q168 F171 R172 T174 P175 R176 R197 Q200
BS02	rna	C	N138 A139 R140 G167 G168 T191 G193 R194 A197 E223 K314 T316 H337 G338 R345 T363 V365	N75 A76 R77 G104 G105 T128 G130 R131 A134 E160 K251 T253 H274 G275 R282 T300 V302
BS03	ADP	C	F82 G109 G111 K112 T113 D371 R399 F400	F19 G46 G48 K49 T50 D308 R336 F337
BS04	BEF	C	K112 R396 R399	K49 R333 R336

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003724 RNA helicase activity
• GO:0005524 ATP binding

External links

• PDB: RCSB:5sup, PDBe:5sup, PDBj:5sup
• PDBsum: 5sup
• PubMed: 28059701
• UniProt: Q07478|SUB2_YEAST ATP-dependent RNA helicase SUB2 (Gene Name=SUB2)