Structure of PDB 5ojj Chain C |
>5ojjC (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] |
ASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKL EVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLN IATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHAR |
|
PDB | 5ojj Mind the Metal: A Fragment Library-Derived Zinc Impurity Binds the E2 Ubiquitin-Conjugating Enzyme Ube2T and Induces Structural Rearrangements. |
Chain | C |
Resolution | 1.85 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
C86 |
Catalytic site (residue number reindexed from 1) |
C83 |
Enzyme Commision number |
2.3.2.23: E2 ubiquitin-conjugating enzyme. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
C86 K91 |
C83 K88 |
|
|
|