Structure of PDB 5oh7 Chain C |
>5oh7C (length=82) Species: 55518 (Magnetospirillum gryphiswaldense) [Search protein sequence] |
GASIFRCRQCGQTISRRDWLLFRVWCFSLAQGLRLIGAPSGEDWTIALCG QCGSHLGWHYEGGSQPQTFFGLIKDRLAEGPA |
|
PDB | 5oh7 Chemical Ligand Space of Cereblon. |
Chain | C |
Resolution | 1.85 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
C24 C27 C90 C93 |
C7 C10 C49 C52 |
|
|
|
|