Structure of PDB 5o4v Chain C

Receptor sequence

>5o4vC (length=368) Species: 5855 (Plasmodium vivax)

DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVC
DVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWH
IGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAP
VLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGF
SVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLP
IENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTT
ATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYL
YNWKCASFAPAHVGIVLL

3D structure

• PDB: 5o4v Fragment-derived inhibitors of human N-myristoyltransferase block capsid assembly and replication of the common cold virus.
• Chain: C
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N161 F162 L163 T197 L410
• Catalytic site (residue number reindexed from 1): N135 F136 L137 T171 L368
• Enzyme Commision number: 2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NHW	C	Y28 F30 W31 Y95 V96 N161 L163 C164 V165 R170 S171 R173 L174 A175 T183 I186 W192 Q193 A194 Y196 T197 A198 L202 Y393	Y2 F4 W5 Y69 V70 N135 L137 C138 V139 R144 S145 R147 L148 A149 T157 I160 W166 Q167 A168 Y170 T171 A172 L176 Y351
BS02	9K2	C	F105 Y211 Y334 N365 A366 L367 L388 L410	F79 Y185 Y292 N323 A324 L325 L346 L368
BS03	MG	C	L169 S171 K172 L174	L143 S145 K146 L148
BS04	9KZ	C	E97 D98 F103 F105 H213 S319	E71 D72 F77 F79 H187 S277

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006499 N-terminal protein myristoylation
• GO:0018008 N-terminal peptidyl-glycine N-myristoylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5o4v, PDBe:5o4v, PDBj:5o4v
• PDBsum: 5o4v
• PubMed: 29760414
• UniProt: A5K1A2