Structure of PDB 5o0d Chain C |
>5o0dC (length=156) Species: 561007 (Mycobacteroides abscessus ATCC 19977) [Search protein sequence] |
SMTGAVCPGSFDPVTLGHLDVFERAAAQFDEVIVAVLINPAGMFTVDERI EMIRESTADLPNLRVESGQGLLVDFVRERGLNAIVKGLRTGTDFEYELQM AQMNKHIAGVDTFFVATAPAYSFVSSSLAKEVATYGGDVSALLPASVHQR LLGKLR |
|
PDB | 5o0d Structural Biology and the Design of New Therapeutics: From HIV and Cancer to Mycobacterial Infections: A Paper Dedicated to John Kendrew. |
Chain | C |
Resolution | 1.539 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H17 R90 S127 |
Catalytic site (residue number reindexed from 1) |
H18 R89 S126 |
Enzyme Commision number |
2.7.7.3: pantetheine-phosphate adenylyltransferase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
9F5 |
C |
G8 S9 L36 |
G9 S10 L37 |
|
|
|
|