Structure of PDB 5nuo Chain C

Receptor sequence

>5nuoC (length=340) Species: 83333 (Escherichia coli K-12)

AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQ
INSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGR
NYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDG
LNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQ
EAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGF
ANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGAT
YYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF

3D structure

• PDB: 5nuo Structural basis for maintenance of bacterial outer membrane lipid asymmetry.
• Chain: C
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	C8E	C	Y263 F265	Y263 F265
BS02	C8E	C	V297 G298	V297 G298
BS03	C8E	C	Y98 Y157	Y98 Y157

Gene Ontology

Molecular Function

• GO:0001530 lipopolysaccharide binding
• GO:0005216 monoatomic ion channel activity
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0015288 porin activity
• GO:0042802 identical protein binding
• GO:0042912 colicin transmembrane transporter activity
• GO:0097718 disordered domain specific binding

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0015031 protein transport
• GO:0034220 monoatomic ion transmembrane transport
• GO:0043213 bacteriocin transport
• GO:0070207 protein homotrimerization

Cellular Component

• GO:0009279 cell outer membrane
• GO:0016020 membrane
• GO:0034702 monoatomic ion channel complex
• GO:0046930 pore complex

External links

• PDB: RCSB:5nuo, PDBe:5nuo, PDBj:5nuo
• PDBsum: 5nuo
• PubMed: 29038444
• UniProt: P02931|OMPF_ECOLI Outer membrane porin F (Gene Name=ompF)