Structure of PDB 5nhu Chain C

Receptor sequence

>5nhuC (length=249) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEKGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQ

3D structure

• PDB: 5nhu Functional analyses yield detailed insight into the mechanism of thrombin inhibition by the antihemostatic salivary protein cE5 from Anopheles gambiae.
• Chain: C
• Resolution: 1.45 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	E328 G330 M331 P333 W334 D433 H436 P437 C439 Y454 K455 R457 N484 M531 K532 N537 R538 W539	E8 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N157 M204 K205 N210 R211 W212
BS02	peptide	C	H363 Y367 W370 K372 E414 N415 L416 R498 I499 D519 A520 E522 G523 S525 W547 G548	H43 Y47 W50 K52 E94 N95 L96 R171 I172 D192 A193 E195 G196 S198 W220 G221

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:5nhu, PDBe:5nhu, PDBj:5nhu
• PDBsum: 5nhu
• PubMed: 28592490
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)