Structure of PDB 5ms4 Chain C

Receptor sequence
>5ms4C (length=228) Species: 9606 (Homo sapiens) [Search protein sequence]
VLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVR
LGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASL
GSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQK
KCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDP
CGRSDKPGVYTNICRYLDWIKKIIGSKG
3D structure
PDB5ms4 Structural determinants of specificity and regulation of activity in the allosteric loop network of human KLK8/neuropsin.
ChainC
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195
Catalytic site (residue number reindexed from 1) H41 D88 Q177 G178 D179 S180
Enzyme Commision number 3.4.21.118: kallikrein 8.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C H57 H99 D189 T190 S195 S214 W215 G216 S217 D218 C220 H41 H85 D174 T175 S180 S195 W196 G197 S198 D199 C201
BS02 CA C D70 S72 L73 N75 D77 E80 D53 S55 L56 N58 D60 E63
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0007613 memory
GO:0009611 response to wounding
GO:0043616 keratinocyte proliferation
GO:0048812 neuron projection morphogenesis
GO:0050807 regulation of synapse organization
GO:0050808 synapse organization
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0030141 secretory granule
GO:0097180 serine protease inhibitor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ms4, PDBe:5ms4, PDBj:5ms4
PDBsum5ms4
PubMed30013126
UniProtO60259|KLK8_HUMAN Kallikrein-8 (Gene Name=KLK8)

[Back to BioLiP]