Structure of PDB 5mmm Chain C

Receptor sequence

>5mmmC (length=253) Species: 3562 (Spinacia oleracea) [Search protein sequence]

QVKSNPRNNLISGQRRCGKGRNARGIITARHRGGGHKRLYRKIDFRRNEK
DIYGKIVTIEYDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIVSGTEV
PIKMGNALPLTDMPLGTAIHNIEITLGRGGQLARAAGAVAKLIAKEGKSA
TLKLPSGEVRLISKNCSATVGQVGNVGVNQKRLGRAGSKRWLGKRPVVRG
VVMNPVDHPHGGGEGRAPIGRKSPTTPWGYPALGRRSRKRNKYSDNFIIR
RRS

3D structure

PDB

5mmm The complete structure of the chloroplast 70S ribosome in complex with translation factor pY.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	V20 R25 N27 G31 K37 G38 R39 N40 A41 R42 I45 T46 A47 R48 R50 G52 K55 R56 L57 Y58 R59 R64 Y79 R83 N84 D94 G95 K97 R146 Q149 L150 A151 R152 A153 A154 K166 L172 P173 S174 E176 R178 V194 N197 R200 L201 G202 R203 A204 G205 K207 R208 W209 R213 P214 V215 V216 R217 G218 V219 V220 M221 N222 V224 D225 H226 H228 G230 G231 E232 G233 R234 P236 I237 G238 R239 P242 P245 W246 Y248 L251 G252 R254 S255 R256 K257 K260 Y261 S262 R269 R270	V2 R7 N9 G13 K19 G20 R21 N22 A23 R24 I27 T28 A29 R30 R32 G34 K37 R38 L39 Y40 R41 R46 Y61 R65 N66 D76 G77 K79 R128 Q131 L132 A133 R134 A135 A136 K148 L154 P155 S156 E158 R160 V176 N179 R182 L183 G184 R185 A186 G187 K189 R190 W191 R195 P196 V197 V198 R199 G200 V201 V202 M203 N204 V206 D207 H208 H210 G212 G213 E214 G215 R216 P218 I219 G220 R221 P224 P227 W228 Y230 L233 G234 R236 S237 R238 K239 K242 Y243 S244 R251 R252
BS02	MG	C	V215 R217	V197 R199

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0009507	chloroplast
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mmm, PDBe:5mmm, PDBj:5mmm
PDBsum	5mmm
PubMed	28007896
UniProt	P06509\|RK2_SPIOL Large ribosomal subunit protein uL2cz/uL2cy (Gene Name=rpl2-A)

[Back to BioLiP]