Structure of PDB 5lzu Chain C

Receptor sequence

>5lzuC (length=362) Species: 9986 (Oryctolagus cuniculus)

ACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQP
YAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM
FAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELP
LVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRR
IQRRGPCVIYNEDNGIVKAFRNIPGITLLNVTKLNILKLAPGGHVGRFCI
WTESAFRKLDDLYGTWRKAASLKSNYNLPMHKMLNTDLSRILKSPEIQRA
LRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRV
ERAAAALAAKSD

3D structure

• PDB: 5lzu Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
• Chain: C
• Resolution: 3.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	A2 C3 A4 R5 P6 K29 R33 I36 N38 F39 T42 R45 K46 N47 N48 R49 Q50 Y52 V54 S55 A58 H60 Q61 T62 S63 T69 G70 A72 V73 A74 R75 I76 P77 R80 G83 H85 R86 Q89 N94 M95 C96 R97 G98 R100 M101 F102 A103 P104 K106 W108 R109 R110 R113 R114 N116 T117 T118 Q119 K120 R121 K140 R143 T164 K165 K172 K181 K182 Y184 R188 R190 A191 G192 K193 K195 M196 R197 N198 R199 R204 R205 K219 R222 N223 K234 L235 N236 P242 G243 H245 R268 K274 S275 M281 H282 R291 Q299 R303 A304 P305 R306 K307 K308 H310 R311 R312 L314 K316 N321 L322 R323 K327 K333 M335 T339 Q343 N346 H347 R350	A1 C2 A3 R4 P5 K28 R32 I35 N37 F38 T41 R44 K45 N46 N47 R48 Q49 Y51 V53 S54 A57 H59 Q60 T61 S62 T68 G69 A71 V72 A73 R74 I75 P76 R79 G82 H84 R85 Q88 N93 M94 C95 R96 G97 R99 M100 F101 A102 P103 K105 W107 R108 R109 R112 R113 N115 T116 T117 Q118 K119 R120 K139 R142 T163 K164 K171 K180 K181 Y183 R187 R189 A190 G191 K192 K194 M195 R196 N197 R198 R203 R204 K218 R221 N222 K233 L234 N235 P241 G242 H244 R267 K273 S274 M280 H281 R290 Q298 R302 A303 P304 R305 K306 K307 H309 R310 R311 L313 K315 N320 L321 R322 K326 K332 M334 T338 Q342 N345 H346 R349
BS02	rna	C	P51 A53 S55 T107 K195 M196	P50 A52 S54 T106 K194 M195

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5lzu, PDBe:5lzu, PDBj:5lzu
• PDBsum: 5lzu
• PubMed: 27863242
• UniProt: G1SVW5|RL4_RABIT Large ribosomal subunit protein uL4 (Gene Name=RPL4)