Structure of PDB 5ld1 Chain C

Receptor sequence
>5ld1C (length=261) Species: 277 (Meiothermus ruber) [Search protein sequence]
MKKYRVQPDGRFELKRFDPDDTSAFEGGKQAALEALAVLNRRLEKLQELL
YAEGQHKVLVVLQAMDAGGKDGTIRVVFDGVNPSGVRVASFGVPTEQELA
RDYLWRVHQQVPRKGELVIFNRSHYEDVLVVRVKNLVPQQVWQKRYRHIR
EFERMLADEGTTILKFFLHISKDEQRQRLQERLDNPEKRWKFRMGDLEDR
RLWDRYQEAYEAAIRETSTEYAPWYVIPANKNWYRNWLVSHILVETLEGL
AMQYPQPIVIE
3D structure
PDB5ld1 Substrate recognition and mechanism revealed by ligand-bound polyphosphate kinase 2 structures.
ChainC
Resolution2.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP C Q47 Y51 N82 G85 Q47 Y51 N82 G85
BS02 ATP C D66 K70 G92 V93 P94 R106 R122 E126 D127 V130 R193 D66 K70 G92 V93 P94 R106 R122 E126 D127 V130 R193
BS03 ATP C D66 A67 G68 G69 K70 D71 R122 R182 K191 D66 A67 G68 G69 K70 D71 R122 R182 K191
BS04 MG C Q109 Q110 V111 Q109 Q110 V111
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 10:53:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5ld1', asym_id = 'C', title = 'Substrate recognition and mechanism revealed by ligand-bound polyphosphate kinase 2 structures.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5ld1', asym_id='C', title='Substrate recognition and mechanism revealed by ligand-bound polyphosphate kinase 2 structures.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006797,0008976,0016776', uniprot = '', pdbid = '5ld1', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006797,0008976,0016776', uniprot='', pdbid='5ld1', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>