Structure of PDB 5j8d Chain C

Receptor sequence
>5j8dC (length=216) Species: 550 (Enterobacter cloacae) [Search protein sequence]
DIISVALKRHSTKAFDASKKLTAEEAEKIKTLLQYSPSSTNSQPWHFIVA
STEEGKARVAKSAAGTYVFNERKMLDASHVVVFCAKTAMDDAWLERVVDQ
EEADGRFNTPEAKAANHKGRTYFADMHRVDLKDDDQWMAKQVYLNVGNFL
LGVGAMGLDAVPIEGFDAAILDEEFGLKEKGFTSLVVVPVGHHSVEDFNA
TLPKSRLPLSTIVTEC
3D structure
PDB5j8d Mechanism-Informed Refinement Reveals Altered Substrate-Binding Mode for Catalytically Competent Nitroreductase.
ChainC
Resolution1.85 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K14 K74 E165
Catalytic site (residue number reindexed from 1) K13 K73 E164
Enzyme Commision number 1.-.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FMN C R10 H11 S12 K14 N71 K74 P163 I164 E165 G166 K205 R207 R9 H10 S11 K13 N70 K73 P162 I163 E164 G165 K204 R206
BS02 DND C S40 T41 R107 F108 Y123 F124 S39 T40 R106 F107 Y122 F123
BS03 FMN C S39 S40 N42 S38 S39 N41
BS04 DND C K14 Y68 F70 N71 K74 G166 F199 K13 Y67 F69 N70 K73 G165 F198
Gene Ontology
Molecular Function
GO:0016491 oxidoreductase activity
Biological Process
GO:0046256 2,4,6-trinitrotoluene catabolic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j8d, PDBe:5j8d, PDBj:5j8d
PDBsum5j8d
PubMed28578873
UniProtQ01234|NFSB_ENTCL Oxygen-insensitive NAD(P)H nitroreductase (Gene Name=nfsB)

[Back to BioLiP]