Structure of PDB 5j4x Chain C

Receptor sequence
>5j4xC (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
3D structure
PDB5j4x Distortion of the ligand molecule as a strategy for modulating binding affinity: Further studies involving complexes of jacalin with beta-substituted disaccharides.
ChainC
Resolution1.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C N105 P107 E109 N110 L133 N105 P107 E109 N110 L133
BS02 peptide C F104 D125 Y126 F127 S128 M129 Y130 L131 F104 D125 Y126 F127 S128 M129 Y130 L131
BS03 peptide C T10 F60 P61 L112 L133 T10 F60 P61 L112 L133
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j4x, PDBe:5j4x, PDBj:5j4x
PDBsum5j4x
PubMed28111895
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]