Structure of PDB 5it1 Chain C

Receptor sequence

>5it1C (length=395) Species: 1950 (Streptomyces peucetius)

TAGAPAAPKARSCPFLPPDGIADIRAAAPVTRATFTSGHEAWLVTGYEQV
RAVLRDPSFSVGVPHALHTQDGVVTQKPGRGSLLWQDAPEHTDDRKLLAK
EFTVRRMQALRPNIQRIVDEHLDAIEARGGPVDLVKTFANPVPSMVISDL
FGVPAERRAEFQEIAEAMMRVDQDAAATEAAGMRLGGLLYQLVQERRANP
GDDLISALITTEDPDGVIDDMFLMNAAGTLLIAAHDTTACMIGLGTALLL
DRPDQLALLQKDPSLIGNAVEELLRYLTIGQFGAERVATQDGEIGGVRIA
KGEQVVTHLLSADFDPAFVEDPERFDITRRPAPHLAFGFGAHQCIGQQLA
RIELQIVFGTLFRRFPTLRLAKPVEELRFRNDMVFYGVHELPVTW

3D structure

• PDB: 5it1 Crystal Structure of Cytochrome P450 (CYP105P2) from Streptomyces peucetius and Its Conformational Changes in Response to Substrate Binding
• Chain: C
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R174 A237 D240 T241 T242 G284 C348 I349 G350 E357 F389
• Catalytic site (residue number reindexed from 1): R170 A233 D236 T237 T238 G280 C344 I345 G346 E353 F385
• Enzyme Commision number: 1.14.14.1: unspecific monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	H95 R99 A237 A238 T241 I283 R290 A340 F341 H346 C348 I349 L353 A354	H91 R95 A233 A234 T237 I279 R286 A336 F337 H342 C344 I345 L349 A350
BS02	2OH	C	P82 A181 G186 G232 T233	P78 A177 G182 G228 T229

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0016712 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:5it1, PDBe:5it1, PDBj:5it1
• PDBsum: 5it1
• PubMed: 27231902
• UniProt: Q70AS3