Structure of PDB 5ii0 Chain C

Receptor sequence
>5ii0C (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
FLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAG
VLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFT
3D structure
PDB5ii0 Type II Turn of Receptor-bound Salmon Calcitonin Revealed by X-ray Crystallography.
ChainC
Resolution2.097 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C F39 Y41 D77 W79 F99 P100 D101 H121 E123 W128 S129 Y131 N135 F1 Y3 D39 W41 F61 P62 D63 H83 E85 W90 S91 Y93 N97
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004948 calcitonin receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ii0, PDBe:5ii0, PDBj:5ii0
PDBsum5ii0
PubMed27189946
UniProtP30988|CALCR_HUMAN Calcitonin receptor (Gene Name=CALCR)

[Back to BioLiP]